PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0628s0006.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 183aa    MW: 20807.3 Da    PI: 6.293
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0628s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.62.1e-081191522154
                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          k +yp++e++++L +++gL+ +q+ +WF N+R +
  Cagra.0628s0006.1.p 119 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 152
                          469*****************************87 PP

2ELK30.39.2e-117394122
                  ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                         ELKh+L+++Y+++++++++E++
  Cagra.0628s0006.1.p 73 ELKHELKQGYKEKIVDIREEIL 94
                         9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512139.9697393IPR005539ELK domain
SMARTSM011886.1E-47394IPR005539ELK domain
PfamPF037893.3E-77394IPR005539ELK domain
PROSITE profilePS5007111.72693156IPR001356Homeobox domain
SuperFamilySSF466891.07E-1695159IPR009057Homeodomain-like
SMARTSM003892.4E-1195160IPR001356Homeobox domain
CDDcd000869.30E-1296157No hitNo description
Gene3DG3DSA:1.10.10.608.2E-26100157IPR009057Homeodomain-like
PfamPF059203.4E-18113152IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MEAVMACWEI EQSLQSLTGV SPGEGMGATM SDDEDEQVES DANMFDGSLD VLGFGPLIPT  60
ESERSLMERV RQELKHELKQ GYKEKIVDIR EEILRKRRAG KLPGDTTSVL KAWWQSHSKW  120
PYPTEEDKAR LVQETGLQLK QINNWFINQR KRNWHSNPSS STVLKNKRKS NAGDNSGRDR  180
FA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A4e-1496160872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529660.0AK352966.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-12-H10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287805.11e-132hypothetical protein CARUB_v10001020mg
SwissprotP480001e-132KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLR0HAQ01e-132R0HAQ0_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__2508__AT5G25220.11e-130(Arabidopsis lyrata)
STRINGAT5G25220.11e-130(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-134KNOTTED1-like homeobox gene 3